PDBe-KB: UniProt Coverage View:
W5PE07
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial in PDB entry 6qc4, assembly 1, front view.](https://www.ebi.ac.uk/pdbe/static/entry/6qc4_entity_48_front_image-200x200.png "Hetero 65-meric assembly 1 of PDB entry <span class='highlight'>6qc4</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial</span>. Front view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial in PDB entry 6qc4, assembly 1, side view.](https://www.ebi.ac.uk/pdbe/static/entry/6qc4_entity_48_side_image-200x200.png "Hetero 65-meric assembly 1 of PDB entry <span class='highlight'>6qc4</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial</span>. Side view.")
![NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial in PDB entry 6qc4, assembly 1, top view.](https://www.ebi.ac.uk/pdbe/static/entry/6qc4_entity_48_top_image-200x200.png "Hetero 65-meric assembly 1 of PDB entry <span class='highlight'>6qc4</span> contains 1 copy of <span class='highlight'>NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial</span>. Top view.")
Chain: S4
Length: 133 amino acids
Theoretical weight: 15.38 KDa
Source organism: Ovis aries
UniProt:
FASTA Sequence
Length: 133 amino acids
Theoretical weight: 15.38 KDa
Source organism: Ovis aries
UniProt:
- Canonical: W5PE07 (Residues: 38-170; Coverage: 78%)
FASTA Sequence
>pdb|6qc4|S4
AQDQTRDTQLITVDEKLDITTLTGVPEEHIKTRKARIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNLVLTFSTKEDAIAFAEKNGWSYDVEERKVPKPKSKSYGANFSWNKRTRVSTK
PDBe-KB: UniProt Coverage View:
W5PE07